GLP-2

When_Pigs_Fly

GLP-1 Novice
🚫No Source Discussion🚫
Member Since
Feb 16, 2026
Posts
17
Likes Received
14
Location
St Augustine, FL
Forgive my ignorance. What is glp-2? I received an email today about an offering of this but I don’t recall ever seeing this before. TYIA.
 

Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion.

Prefer vendors that don't use silly names to talk about tirzepatide, or retatrutide.
 
After the government started cracking down a few months ago, most US Pep resellers have switched to referring to Semaglutide as GLP-1 (or something like that), Tirzepatide as GLP-2, and Retatrutide as retatrutide (because there is no such thing as "GLP-3"). It doesn't refer to the GLP-2 peptide itself.
 
After the government started cracking down a few months ago, most US Pep resellers have switched to referring to Semaglutide as GLP-1 (or something like that), Tirzepatide as GLP-2, and Retatrutide as retatrutide (because there is no such thing as "retatrutide (because there is no such thing as "GLP-3")"). It doesn't refer to the GLP-2 peptide itself.
I've actually seen a couple of vendors that do refer to it as retatrutide (because there is no such thing as "GLP-3") 😂
 
Reading all this is giving me pause. I have never filtered. Can someone point me to a source for the filtering supplies and possibly instructions on how to do it, filtering for dummies? Thanks.
 
Reading all this is giving me pause. I have never filtered. Can someone point me to a source for the filtering supplies and possibly instructions on how to do it, filtering for dummies? Thanks.
Here you go:

I was filtering a couple of days ago and got lost in my steps, I'm pretty absent minded these days, so I decided to write these down for my own use. I wrote these based on the video I posted from Peptide test. It seems like a lot of needles, but needles are so inexpensive, it makes sense to discard when they are man handled. I'm sure I'll pick up speed the more and more I filter and probably won't need a checklist eventually.


Step 0. Thoroughly wipe down the work surface with 70% isopropyl alcohol (IPA) and allow to fully dry before placing any materials. Wipe all vial stoppers and cartridge septa with 70% IPA and allow to dry prior to use.
Step 1. Reconstitute lyophilized peptide per standard protocol.
Step 2. Detach the reconstitution needle from the luer-lock syringe; safely discard the needle.
Step 3. Insert a sterile venting needle into the destination vial or cartridge to equalize pressure during transfer. (Optional: fit the venting needle with a 0.22 µm filter to maintain sterility of the headspace prior to insertion if so desired.)
Step 4. Attach a fresh drawing needle to the luer-lock syringe.
Step 5. Draw the full volume of reconstituted peptide into the syringe.
Step 6. Detach the drawing needle from the luer-lock syringe; safely discard the needle.
Step 7. Attach a sterile 0.22 µm syringe filter directly to the luer-lock tip of the syringe. Attach a sterile needle to the outlet port of the filter.
Step 8. Pierce the septum of the destination vessel with the outlet needle and express the peptide solution through the filter into the destination vessel.

Optional: Filter Recovery Flush
(Recovers the dead volume / hold-up volume retained within the filter housing — typically 0.1–0.2 mL (10–20 units on a U-100 syringe), depending on filter size.)

Step 9. With the venting needle still seated in the destination vessel, carefully disconnect the luer-lock syringe from the inlet of the filter, leaving the filter and outlet needle in place in the septum.
Step 10. Attach a fresh drawing needle to the now-empty luer-lock syringe.
Step 11. Draw an appropriate volume of bacteriostatic water into the syringe — typically equal to or slightly greater than the filter's rated hold-up volume (e.g., 0.1–0.2 mL / 10–20 units on a U-100 syringe).
Step 12. Detach the drawing needle from the luer-lock syringe; safely discard the needle.
Step 13. Reconnect the luer-lock syringe (containing bacteriostatic water) to the inlet port of the filter assembly from Step 9.
Step 14. Slowly express the bacteriostatic water through the filter to flush retained peptide into the destination vessel.
Step 15. Remove the filter assembly and venting needle. Cap or seal the destination vessel. Gently swirl or invert to mix the flush volume with the filtered peptide. Label with peptide name, concentration (adjusted for flush dilution if relevant), reconstitution date, and diluent used.
 
Reading all this is giving me pause. I have never filtered. Can someone point me to a source for the filtering supplies and possibly instructions on how to do it, filtering for dummies? Thanks.
View: https://m.youtube.com/watch?v=fmz4241qPn4&pp=ygUSZmlsdGVyaW5nIHBlcHRpZGVz



Not nearly as stressful as I pictured it being.
I bought my filters (just the filter tips, butb they sell kits) from undergroundsupply shop. Just make sure you get the 4mm filter as there is less product getting wasted in that size. I already have sterile syringes that I get from the farm stores for my animals and they are essentially identical.
 
Reading all this is giving me pause. I have never filtered. Can someone point me to a source for the filtering supplies and possibly instructions on how to do it, filtering for dummies? Thanks.
I just filtered for the first time a couple weeks ago. I was nervous at first but it was easier than I thought it would be. Just watch some videos and you will get the hang of it. As long as you have all of the supplies you need, you will be good.
 
View: https://m.youtube.com/watch?v=fmz4241qPn4&pp=ygUSZmlsdGVyaW5nIHBlcHRpZGVz



Not nearly as stressful as I pictured it being.
I bought my filters (just the filter tips, butb they sell kits) from undergroundsupply shop. Just make sure you get the 4mm filter as there is less product getting wasted in that size. I already have sterile syringes that I get from the farm stores for my animals and they are essentially identical.
The written Peptide Test instructions that go with the video are attached. An excerpt:

1776575249138.webp
But few people do the last step of #4 ("attach a...syringe filter to your vent needle.")

Of course, most people don't filter their peptides. Some potentially mitigating strategies (listed here) are buying smaller-mg vials (so you aren't using the vials as long) and letting the reconned solution rest for 24 hours.
 

Attachments

Last edited:

Trending Topics

Forum Statistics

Threads
18,313
Posts
191,228
Members
61,317
Newest
glp1enthusiast
Back
Top Bottom